McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM74-2:1

Chromosome

chr8

Gene Name

lnc-TMEM74-2

Start

108606849

CPC Label

noncoding

End

108787594

Cancer

PRAD

Strand

-

Peptide

LIMNSWAQAILQTWPPK

Modified Peptide

LIM[147]NSWAQAILQTWPPK

Peptide Length

17

ORF Length

77

Open Reading Frame (ORF)

LGDFLREPCRESARCWSRTGWPKQKRHGLAMLPRLIMNSWAQAILQTWPPKVLGFQQRRFKKIPEVVKTLMLNIMFQ

Conservation Score

0.958

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.0301814

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.953

PhyloCSF Frame 3

0

CNTI Score

-0.327524207