McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM70-4:2

Chromosome

chr8

Gene Name

lnc-TMEM70-4

Start

73984021

CPC Label

coding

End

73984899

Cancer

EOGC

Strand

+

Peptide

CALYDASFETK

Modified Peptide

n[145]CALYDASFETK

Peptide Length

11

ORF Length

119

Open Reading Frame (ORF)

LPTGSLPRIPATPEAKMASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLGADEKCIIVEEGKEILVGDVGVTITGPFKHFVGMLPEKDCRCALYDASFETKESSTEELIFFL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.707511

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.5533

PhyloCSF Frame 3

0

CNTI Score

0.638630705