McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM68-4:1

Chromosome

chr8

Gene Name

lnc-TMEM68-4

Start

55135202

CPC Label

noncoding

End

55142358

Cancer

OSCC

Strand

-

Peptide

MATSPTR

Modified Peptide

n[145]MATSPTR

Peptide Length

7

ORF Length

59

Open Reading Frame (ORF)

MATSPTRRGLRASFNDMKFCRLTSRSAGEDKALRRAAVRPVGSLWGKEWRVCRWNSPLR

Conservation Score

0.035

PhyloCSF Frame 1

-5.343

No. of Spectra

1

CPC Coding Probability

0.0490573

PhyloCSF Frame 2 

-4.651

CNTI Index

noncoding

Max Probability

0.9966

PhyloCSF Frame 3

-4.053

CNTI Score

-0.361766587