McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM65-1:1

Chromosome

chr8

Gene Name

lnc-TMEM65-1

Start

124192670

CPC Label

noncoding

End

124247398

Cancer

OV

Strand

-

Peptide

KTSGISQK

Modified Peptide

n[145]KTSGISQK

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

LGPFTEAIRKTSGISQKTECKRTKGPGTVAHSCNPRTLGD

Conservation Score

0.029

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0558652

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

0

CNTI Score

-0.358428812