McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM63B-1:1

Chromosome

chr6

Gene Name

lnc-TMEM63B-1

Start

44073912

CPC Label

noncoding

End

44077952

Cancer

BRCA-Luminal A

Strand

+

Peptide

ATWAYLSSSHLGSTCGLTSSPLLTG

Modified Peptide

n[145]ATWAYLSSSHLGSTCGLTSSPLLTG

Peptide Length

25

ORF Length

80

Open Reading Frame (ORF)

MSIAVPPTGWDTSYSVQPLPTLLPGSGRKAGNLRCPFPFGLLEGSNSLILLFLPRATWAYLSSSHLGSTCGLTSSPLLTG

Conservation Score

1

PhyloCSF Frame 1

-3.566

No. of Spectra

1

CPC Coding Probability

0.116589

PhyloCSF Frame 2 

-2.311

CNTI Index

noncoding

Max Probability

0.71

PhyloCSF Frame 3

-1.785

CNTI Score

-0.330673989