McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM45B-2:1

Chromosome

chr11

Gene Name

lnc-TMEM45B-2

Start

129694617

CPC Label

noncoding

End

129698245

Cancer

OV

Strand

+

Peptide

SGQPGIGCQSSSPSSAK

Modified Peptide

n[145]SGQPGIGCQSSSPSSAK

Peptide Length

17

ORF Length

91

Open Reading Frame (ORF)

LLCCHGVQSSGRFIHIYAPEWYWPPRNGVDIKQRSGQPGIGCQSSSPSSAKRKSSHECLPSRSVTGRPSGVYQKHFLRCKAAKKGSLYSGL

Conservation Score

0.088

PhyloCSF Frame 1

-4.943

No. of Spectra

1

CPC Coding Probability

0.242732

PhyloCSF Frame 2 

-2.714

CNTI Index

noncoding

Max Probability

0.2131

PhyloCSF Frame 3

-4.653

CNTI Score

-0.28794485