McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM38B-2:1

Chromosome

chr9

Gene Name

lnc-TMEM38B-2

Start

105849709

CPC Label

coding

End

105850603

Cancer

OV

Strand

+

Peptide

GADVRYMGILDCWTKILK

Modified Peptide

n[145]GADVRYM[147]GILDCWTKILK

Peptide Length

18

ORF Length

46

Open Reading Frame (ORF)

MMMQCWHKGADVRYMGILDCWTKILKDEESKAFFKGAWSNILRGME

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.941105

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.0516

PhyloCSF Frame 3

0

CNTI Score

0.674153265