McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM38A-2:1

Chromosome

chr19

Gene Name

lnc-TMEM38A-2

Start

16630742

CPC Label

noncoding

End

16638950

Cancer

PRAD

Strand

+

Peptide

KGEEGLGAEGPR

Modified Peptide

‚Äč

Peptide Length

12

ORF Length

34

Open Reading Frame (ORF)

MPLKKLPHLFVKGTPKRKGEEGLGAEGPRHRTQV

Conservation Score

0.088

PhyloCSF Frame 1

-4.635

No. of Spectra

5

CPC Coding Probability

0.0185657

PhyloCSF Frame 2 

-5.07

CNTI Index

noncoding

Max Probability

0.9584

PhyloCSF Frame 3

-5.264

CNTI Score

-0.38613736