McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM37-1:1

Chromosome

chr2

Gene Name

lnc-TMEM37-1

Start

119476447

CPC Label

noncoding

End

119487346

Cancer

OSCC

Strand

+

Peptide

LFSLMENLSLGR

Modified Peptide

n[145]LFSLM[147]ENLSLGR

Peptide Length

12

ORF Length

52

Open Reading Frame (ORF)

LFSLMENLSLGRVRLSVIHSSVVLCLIRLDGKAESCFGSVRSWAPWSLFSHL

Conservation Score

0.981

PhyloCSF Frame 1

-2.414

No. of Spectra

2

CPC Coding Probability

0.0394512

PhyloCSF Frame 2 

-5.256

CNTI Index

noncoding

Max Probability

0.7085

PhyloCSF Frame 3

-4.519

CNTI Score

-0.2924447