McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM30A-2:1

Chromosome

chr6

Gene Name

lnc-TMEM30A-2

Start

75319100

CPC Label

noncoding

End

75319980

Cancer

CCRC

Strand

-

Peptide

CEIILLQMTSSLMK

Modified Peptide

n[230]CEIILLQM[147]TSSLMK

Peptide Length

14

ORF Length

47

Open Reading Frame (ORF)

MFCSEYRPKIKEEHPGLPIGDAGRNWDRCEIILLQMTSSLMKRRLRS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.14807

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7422

PhyloCSF Frame 3

0

CNTI Score

-0.355231704