McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM255B-5:31

Chromosome

chr13

Gene Name

lnc-TMEM255B-5

Start

113907840

CPC Label

coding

End

113934303

Cancer

OV

Strand

+

Peptide

SSLAQGHTAGR

Modified Peptide

n[145]SSLAQGHTAGR

Peptide Length

11

ORF Length

106

Open Reading Frame (ORF)

MRGPRRDSRQGPGLGNAAHGPDPSRPATAMPISAEATEVWRRSSLAQGHTAGRLARFMLRVFPASPRGPLMSGLGDAFANVLAEQMPQGLSCGSTMSPSSSPQSLP

Conservation Score

0.017

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.920507

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9576

PhyloCSF Frame 3

0

CNTI Score

0.705494447