McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM253-3:1

Chromosome

chr14

Gene Name

lnc-TMEM253-3

Start

21162512

CPC Label

noncoding

End

21163743

Cancer

CCRC

Strand

+

Peptide

EVADQAK

Modified Peptide

EVADQAK

Peptide Length

7

ORF Length

55

Open Reading Frame (ORF)

LCGLKVEVDMEKIAAEIAQAEEQTHKRQEEREREVADQAKRSQSGIVPEQEHAAN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.36198

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.834

PhyloCSF Frame 3

0

CNTI Score

0.682795913