McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM252-2:1

Chromosome

chr9

Gene Name

lnc-TMEM252-2

Start

68398091

CPC Label

noncoding

End

68406500

Cancer

OV

Strand

-

Peptide

NIQYHAVCLAHK

Modified Peptide

n[145]NIQYHAVCLAHK

Peptide Length

12

ORF Length

35

Open Reading Frame (ORF)

LLAVKFAKGKGNMEGKMSSIRNIQYHAVCLAHKRG

Conservation Score

0.089

PhyloCSF Frame 1

-5.667

No. of Spectra

5

CPC Coding Probability

0.0180171

PhyloCSF Frame 2 

-5.541

CNTI Index

noncoding

Max Probability

0.7524

PhyloCSF Frame 3

-5.942

CNTI Score

-0.382028753