McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM251-2:1

Chromosome

chr14

Gene Name

lnc-TMEM251-2

Start

93138065

CPC Label

noncoding

End

93138465

Cancer

CCRC

Strand

+

Peptide

TYIIQEPHPDDRPK

Modified Peptide

TYIIQEPHPDDRPK

Peptide Length

14

ORF Length

41

Open Reading Frame (ORF)

MELSKTYIIQEPHPDDRPKLNKLRKLLSLLLILAPVGGPTE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

19

CPC Coding Probability

0.0292642

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

0

CNTI Score

-0.310782063