McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM250-2:7

Chromosome

chr9

Gene Name

lnc-TMEM250-2

Start

136107807

CPC Label

coding

End

136109081

Cancer

PRAD

Strand

-

Peptide

SGEEEGHLVEVGSGK

Modified Peptide

‚Äč

Peptide Length

15

ORF Length

64

Open Reading Frame (ORF)

LRRRSRGRSGEEEGHLVEVGSGKDTVVGKGQGAGGVPGRSVVRGWVLVGPGDGGAASTLLSLEA

Conservation Score

0.037

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.821819

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9317

PhyloCSF Frame 3

0

CNTI Score

-0.329458522