McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM248-4:11

Chromosome

chr7

Gene Name

lnc-TMEM248-4

Start

66887270

CPC Label

noncoding

End

66890640

Cancer

OV

Strand

+

Peptide

MHNHAPLISVLLVETGFHPVSK

Modified Peptide

n[145]MHNHAPLISVLLVETGFHPVSK

Peptide Length

22

ORF Length

69

Open Reading Frame (ORF)

MHNHAPLISVLLVETGFHPVSKAGHKLLTSGDSPASASQSAGITGVSHCSWPRAETLTPCSLLFPGHLL

Conservation Score

0.097

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0391747

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6543

PhyloCSF Frame 3

0

CNTI Score

-0.356262325