McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM244-2:1

Chromosome

chr6

Gene Name

lnc-TMEM244-2

Start

129783768

CPC Label

noncoding

End

129784045

Cancer

HCC

Strand

-

Peptide

IADNHIPK

Modified Peptide

n[230]IADNHIPK

Peptide Length

8

ORF Length

46

Open Reading Frame (ORF)

LPVLGVPVNSLRFLFEGQRIADNHIPKDLRMCVHKRFDSTLSRTNG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.00550049

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7501

PhyloCSF Frame 3

0

CNTI Score

-0.46941695