McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM240-2:1

Chromosome

chr1

Gene Name

lnc-TMEM240-2

Start

1470620

CPC Label

noncoding

End

1512015

Cancer

EOGC

Strand

-

Peptide

GVDGAGVPGQAPPR

Modified Peptide

n[145]GVDGAGVPGQAPPR

Peptide Length

14

ORF Length

124

Open Reading Frame (ORF)

LAAAGGKFPGSPKVLDPCGGAPCGESRTQRRVSREPHPRRHRRPGKPSPSAMSRRPGVAAPRAQERRLPSSVSPQPARPSRPRPRGDPFPRGGASELLLRGVDGAGVPGQAPPRSPRSTRSQRP

Conservation Score

0.211

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0512041

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9731

PhyloCSF Frame 3

0

CNTI Score

-0.302156154