McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM238L-16:4

Chromosome

chr17

Gene Name

lnc-TMEM238L-16

Start

10801785

CPC Label

coding

End

10804064

Cancer

OV

Strand

-

Peptide

ATVHWAAIPSSPGGPNLHAGVSR

Modified Peptide

n[145]ATVHWAAIPSSPGGPNLHAGVSR

Peptide Length

23

ORF Length

146

Open Reading Frame (ORF)

MGYKKRGRDYSPPCPLSAHTSSLCSIPTPPSLTLTRSQHMCPASLQGPEVKTVWLHGFHPLSCMSQLSLSRATKEAESCKIFSHQDRVPEIEWSGPYNPELEMDSCLQGTEVRATVHWAAIPSSPGGPNLHAGVSRHSRFLLPYQK

Conservation Score

0.689

PhyloCSF Frame 1

-2.563

No. of Spectra

2

CPC Coding Probability

0.663561

PhyloCSF Frame 2 

-2.302

CNTI Index

noncoding

Max Probability

0.174

PhyloCSF Frame 3

-2.444

CNTI Score

-0.323883068