McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM238L-16:1

Chromosome

chr17

Gene Name

lnc-TMEM238L-16

Start

10794905

CPC Label

noncoding

End

10838094

Cancer

EOGC

Strand

-

Peptide

LAGMDLSR

Modified Peptide

n[145]LAGMDLSR

Peptide Length

8

ORF Length

63

Open Reading Frame (ORF)

LAGMDLSRNSLPASSLHEHQVIPRSPILPWDIEDSALILALSLLLWIIWYSLNIEVSPEKLDL

Conservation Score

1

PhyloCSF Frame 1

-3.192

No. of Spectra

30

CPC Coding Probability

0.0319387

PhyloCSF Frame 2 

4.99

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-2.84

CNTI Score

-0.35120679