McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM235-47:1

Chromosome

chr17

Gene Name

lnc-TMEM235-47

Start

78248192

CPC Label

coding

End

78251440

Cancer

PRAD

Strand

+

Peptide

LPLPQHQFSVLHR

Modified Peptide

Peptide Length

13

ORF Length

242

Open Reading Frame (ORF)

LVTGAGRVSFLSLHPVPDTGGIQCVLTSMGEVLTLSVVGVKGTKEPQEQVTPPLLPACWEHLHSLLPPQPGHRVPVTPSSGLQRPQHKLPLPQHQFSVLHRDVAVPHGSTDCSVHRNSGTHATWPVWASSSALTARNPAMLTTTMFVSTKVGSTEQTDNTSSWSPGPGPEVPAWCLGRGFAPEQPVLAGGCPGPQVSNACSLPEPPHPAHRRGGGTPAQGGAGSPGASSDTSLRQKEGRSWH

Conservation Score

1

PhyloCSF Frame 1

4.04

No. of Spectra

6

CPC Coding Probability

0.993361

PhyloCSF Frame 2 

-2.09

CNTI Index

noncoding

Max Probability

0.9421

PhyloCSF Frame 3

5.507

CNTI Score

-0.311592934