McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM234-4:1

Chromosome

chr1

Gene Name

lnc-TMEM234-4

Start

32193200

CPC Label

noncoding

End

32200357

Cancer

OSCC

Strand

-

Peptide

ALQDAVNALCATSPPGSQR

Modified Peptide

n[145]ALQDAVNALCATSPPGSQR

Peptide Length

19

ORF Length

57

Open Reading Frame (ORF)

LIPRRKALQDAVNALCATSPPGSQRCPPPITRNGKGPGMVAHAYNPSTLGGQGGQIT

Conservation Score

0.113

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.15323

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8477

PhyloCSF Frame 3

0

CNTI Score

-0.307611428