McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM234-1:4

Chromosome

chr1

Gene Name

lnc-TMEM234-1

Start

32203323

CPC Label

coding

End

32208665

Cancer

EOGC

Strand

-

Peptide

YLSAPLLFFCFLR

Modified Peptide

n[145]YLSAPLLFFCFLR

Peptide Length

13

ORF Length

67

Open Reading Frame (ORF)

LPPGLSYLLPKYLSAPLLFFCFLRQSLALLPRLECSGVISAHCNLASWVQVILLPQPPKLLALWAPA

Conservation Score

0.915

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.55982

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9577

PhyloCSF Frame 3

0

CNTI Score

0.698283753