McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM234-1:2

Chromosome

chr1

Gene Name

lnc-TMEM234-1

Start

32204768

CPC Label

noncoding

End

32206185

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

SLITHLGGR

Modified Peptide

n[145]SLITHLGGR

Peptide Length

9

ORF Length

86

Open Reading Frame (ORF)

LVWRTRGKKSLITHLGGRRTPARVCKKSQFEENERGSVGLRGTPTQRTAPQARRSRPGAASGCARQGSWRFGPVLPPTPVSHLAQV

Conservation Score

1

PhyloCSF Frame 1

-1.198

No. of Spectra

2

CPC Coding Probability

0.141352

PhyloCSF Frame 2 

-2.519

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

12.248

CNTI Score

-0.354968347