McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM230-4:1

Chromosome

chr20

Gene Name

lnc-TMEM230-4

Start

5045760

CPC Label

noncoding

End

5046276

Cancer

BRCA-Luminal A

Strand

-

Peptide

MIMWFLSVIQLLLCITLTDSGIDFK

Modified Peptide

n[145]M[147]IM[147]WFLSVIQLLLCITLTDSGIDFK

Peptide Length

25

ORF Length

51

Open Reading Frame (ORF)

LTKMIMWFLSVIQLLLCITLTDSGIDFKAFIPPNTLPGLGLLPLHVFRKKT

Conservation Score

0.27

PhyloCSF Frame 1

0

No. of Spectra

29

CPC Coding Probability

0.0201578

PhyloCSF Frame 2 

-4.43

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

0

CNTI Score

-0.470818501