McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM220-3:1

Chromosome

chr17

Gene Name

lnc-TMEM220-3

Start

10745552

CPC Label

noncoding

End

10746543

Cancer

BRCA-Luminal B

Strand

-

Peptide

LHGGANKMK

Modified Peptide

n[145]LHGGANKMK

Peptide Length

9

ORF Length

46

Open Reading Frame (ORF)

MYFDDYNFQKKSTLHPVVRLHGGANKMKKSYTTPKKKSRRERRLTG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0439917

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9759

PhyloCSF Frame 3

0

CNTI Score

-0.352662704