McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM220-2:2

Chromosome

chr17

Gene Name

lnc-TMEM220-2

Start

10735637

CPC Label

noncoding

End

10744762

Cancer

OV

Strand

-

Peptide

TGSCIAATGK

Modified Peptide

n[145]TGSCIAATGK

Peptide Length

10

ORF Length

78

Open Reading Frame (ORF)

LLKCVTALSFFFFFFFFKTGSCIAATGKLYALGVESLGGSMLRVIYSYNISLYPHSPWILFISRYVRCYWREEKINRL

Conservation Score

0.052

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.124574

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8989

PhyloCSF Frame 3

0

CNTI Score

-0.334275092