McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM211-7:1

Chromosome

chr22

Gene Name

lnc-TMEM211-7

Start

25052121

CPC Label

coding

End

25065241

Cancer

OV

Strand

-

Peptide

ACKSGFQAPR

Modified Peptide

n[145]ACKSGFQAPR

Peptide Length

10

ORF Length

81

Open Reading Frame (ORF)

LLEKLDDPTNILGKEELGCKGSSFLPTICHEIPIPAWPGFRAQLPMQNPRERACKSGFQAPRCPGCLAGGLAFRNPQIRDF

Conservation Score

0.152

PhyloCSF Frame 1

-4.093

No. of Spectra

1

CPC Coding Probability

0.552162

PhyloCSF Frame 2 

-4.042

CNTI Index

noncoding

Max Probability

0.2995

PhyloCSF Frame 3

-4.287

CNTI Score

-0.284139499