McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM211-2:8

Chromosome

chr22

Gene Name

lnc-TMEM211-2

Start

25102240

CPC Label

noncoding

End

25112711

Cancer

OV

Strand

-

Peptide

DWGGLYFSTGGVAMATR

Modified Peptide

n[145]DWGGLYFSTGGVAM[147]ATR

Peptide Length

17

ORF Length

113

Open Reading Frame (ORF)

LGPLVGCQSVSLSWSVSLLISQPRSPPSPCVSTSTCLSLSVSPLSLLFSCLSLPLWKATLIQVRQPLRSPRKDWGGLYFSTGGVAMATRGTASALSWAAGSALGAMGMIHGLH

Conservation Score

1

PhyloCSF Frame 1

-2.998

No. of Spectra

1

CPC Coding Probability

0.350514

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8009

PhyloCSF Frame 3

0

CNTI Score

-0.301145122