McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM211-1:1

Chromosome

chr22

Gene Name

lnc-TMEM211-1

Start

25027190

CPC Label

coding

End

25029327

Cancer

CCRC

Strand

-

Peptide

AGGAPEASPAWR

Modified Peptide

n[230]AGGAPEASPAWR

Peptide Length

12

ORF Length

149

Open Reading Frame (ORF)

LAATSGREPDTPSLASSAPSLTAFPRAGPLLVVSKRIMVLELGRRNTALLKRGELVLGPSPLPTSCPTKPGILLSRSFAAGSSESPPEGEGPVELGRRDGTGDFTSCSFEKGLGASLGRGSNRAGLRRGLFASKIRAGGAPEASPAWRK

Conservation Score

1

PhyloCSF Frame 1

-4.802

No. of Spectra

1

CPC Coding Probability

0.60961

PhyloCSF Frame 2 

10.16

CNTI Index

noncoding

Max Probability

0.4643

PhyloCSF Frame 3

-2.696

CNTI Score

-0.310878755