McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM189-2:2

Chromosome

chr20

Gene Name

lnc-TMEM189-2

Start

50242099

CPC Label

noncoding

End

50274912

Cancer

OV

Strand

-

Peptide

GENPASPK

Modified Peptide

n[145]GENPASPK

Peptide Length

8

ORF Length

62

Open Reading Frame (ORF)

LTPTSQKLLPGTKKGENPASPKSSAMPASWMPSGTGAWVTGPRMGPWPGRSLGAQTHLRPAG

Conservation Score

1

PhyloCSF Frame 1

-4.463

No. of Spectra

37

CPC Coding Probability

0.189835

PhyloCSF Frame 2 

-1.294

CNTI Index

noncoding

Max Probability

0.9898

PhyloCSF Frame 3

-1.985

CNTI Score

-0.288038731