McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM185B-7:1

Chromosome

chr2

Gene Name

lnc-TMEM185B-7

Start

119993198

CPC Label

noncoding

End

119993611

Cancer

LUAD

Strand

-

Peptide

LPTRYSVDIPLDK

Modified Peptide

LPTRYSVDIPLDK

Peptide Length

13

ORF Length

54

Open Reading Frame (ORF)

LPTRYSVDIPLDKTVVSNDVFRDPALKRRARREAKVKFQDRNKMGKNEWFFQKL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.113456

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4182

PhyloCSF Frame 3

0

CNTI Score

-0.322552265