McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM185B-1:6

Chromosome

chr2

Gene Name

lnc-TMEM185B-1

Start

120217470

CPC Label

coding

End

120219514

Cancer

OV

Strand

-

Peptide

EPSHVGRSSRR

Modified Peptide

n[145]EPSHVGRSSRR

Peptide Length

11

ORF Length

33

Open Reading Frame (ORF)

LESKVSPEGYARRFGKAKPGRREPSHVGRSSRR

Conservation Score

0.038

PhyloCSF Frame 1

-4.731

No. of Spectra

3

CPC Coding Probability

0.88929

PhyloCSF Frame 2 

-3.224

CNTI Index

noncoding

Max Probability

0.3789

PhyloCSF Frame 3

-5.355

CNTI Score

-0.308739463