McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM184C-2:1

Chromosome

chr4

Gene Name

lnc-TMEM184C-2

Start

147486828

CPC Label

noncoding

End

147492655

Cancer

OV

Strand

+

Peptide

YILHSGEVK

Modified Peptide

n[145]YILHSGEVK

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

MYILHSGEVKAFRVSITKIIYIVPTMKFLIIHS

Conservation Score

0.118

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0886021

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6994

PhyloCSF Frame 3

0

CNTI Score

-0.347185701