McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM183A-5:4

Chromosome

chr1

Gene Name

lnc-TMEM183A-5

Start

202861753

CPC Label

noncoding

End

202867308

Cancer

BRCA-Luminal B

Strand

+

Peptide

MLLVHYFFPVVVSYCSMLK

Modified Peptide

n[145]MLLVHYFFPVVVSYCSM[147]LK

Peptide Length

19

ORF Length

33

Open Reading Frame (ORF)

MLLVHYFFPVVVSYCSMLKSIHILFPFSKLFLS

Conservation Score

0.045

PhyloCSF Frame 1

-4.546

No. of Spectra

5

CPC Coding Probability

0.169377

PhyloCSF Frame 2 

-5.251

CNTI Index

noncoding

Max Probability

0.4899

PhyloCSF Frame 3

-5.66

CNTI Score

-0.343961864