McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM183A-5:2

Chromosome

chr1

Gene Name

lnc-TMEM183A-5

Start

202861753

CPC Label

noncoding

End

202875241

Cancer

BRCA-Luminal B

Strand

+

Peptide

DSYLGDEAQSK

Modified Peptide

n[145]DSYLGDEAQSK

Peptide Length

11

ORF Length

72

Open Reading Frame (ORF)

LSLTMAPAHAKLALLGIVPRAMFPSITGYPWHQGMMVGIGQKDSYLGDEAQSKCSILTLKVPRGPPHHHQLG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

56

CPC Coding Probability

0.230153

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

0.716122378