McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM182-10:1

Chromosome

chr2

Gene Name

lnc-TMEM182-10

Start

103527619

CPC Label

noncoding

End

103529261

Cancer

HCC

Strand

+

Peptide

QTLIGTLK

Modified Peptide

n[230]QTLIGTLK

Peptide Length

8

ORF Length

117

Open Reading Frame (ORF)

LKQTLIGTLKVENLPSFNTKEFTVEKGHLSEVNMGNPFAKALTSFRTGGLTLKQVRVDAVNVGNYLFQNPPCSTPKSSQWNAVIMGNPLAKALVSFDTEGFICNEYGKYFCCKSDLI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.0697674

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.379864173