McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM18-7:1

Chromosome

chr2

Gene Name

lnc-TMEM18-7

Start

554474

CPC Label

noncoding

End

559467

Cancer

OV

Strand

-

Peptide

SPPGHGDSPGGAGR

Modified Peptide

n[145]SPPGHGDSPGGAGR

Peptide Length

14

ORF Length

48

Open Reading Frame (ORF)

MSPPGHGDSPGGAGRAPDQNRMRTVLKTVNCKNRSLPRRMTVLRLHSS

Conservation Score

0.029

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.054215

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9603

PhyloCSF Frame 3

0

CNTI Score

-0.350578273