McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM18-20:1

Chromosome

chr2

Gene Name

lnc-TMEM18-20

Start

1037387

CPC Label

noncoding

End

1041240

Cancer

OV

Strand

-

Peptide

SMWISAMAGR

Modified Peptide

n[145]SMWISAM[147]AGR

Peptide Length

10

ORF Length

43

Open Reading Frame (ORF)

LKHEKGKFMFQEAKFFYYQQVNVFGRSMWISAMAGRNSNQKDP

Conservation Score

0.008

PhyloCSF Frame 1

-5.634

No. of Spectra

21

CPC Coding Probability

0.0812935

PhyloCSF Frame 2 

-3.755

CNTI Index

noncoding

Max Probability

0.8996

PhyloCSF Frame 3

-4.964

CNTI Score

-0.335015902