McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM18-16:1

Chromosome

chr2

Gene Name

lnc-TMEM18-16

Start

542215

CPC Label

noncoding

End

545617

Cancer

OV

Strand

-

Peptide

EAEVYLQK

Modified Peptide

n[145]EAEVYLQK

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

MPAFVIARLINTVLQKEAEVYLQKEFLLLQVYLQKEL

Conservation Score

0.177

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0229004

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9633

PhyloCSF Frame 3

0

CNTI Score

-0.328293325