McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM179-2:10

Chromosome

chr14

Gene Name

lnc-TMEM179-2

Start

104358581

CPC Label

noncoding

End

104362056

Cancer

OV

Strand

-

Peptide

TQALPKHCSHPWPVGSK

Modified Peptide

n[145]TQALPKHCSHPWPVGSK

Peptide Length

17

ORF Length

102

Open Reading Frame (ORF)

LVFGFSASVPTTQNSNGGWEQGLALTQTPPPCSRAAKSRADSQNNFHRTEPRGSSARTQALPKHCSHPWPVGSKVSSASFPRMPEPQRRCQNIPYSSLRKPA

Conservation Score

0.336

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.221892

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1478

PhyloCSF Frame 3

0

CNTI Score

-0.367124028