McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM178A-1:8

Chromosome

chr2

Gene Name

lnc-TMEM178A-1

Start

39437424

CPC Label

coding

End

39498559

Cancer

HCC

Strand

+

Peptide

HHVWLLEK

Modified Peptide

HHVWLLEK

Peptide Length

8

ORF Length

76

Open Reading Frame (ORF)

LGLQMRHHVWLLEKFYNFYVLKAGKEKNLGLVSVITSSIKSDFKMKISPREIQAGGSSIQLSLSFNIVVILDPSFP

Conservation Score

1

PhyloCSF Frame 1

-4.426

No. of Spectra

10

CPC Coding Probability

0.943331

PhyloCSF Frame 2 

-2.61

CNTI Index

coding

Max Probability

0.9993

PhyloCSF Frame 3

-5.202

CNTI Score

0.609503311