McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM178A-1:6

Chromosome

chr2

Gene Name

lnc-TMEM178A-1

Start

39437415

CPC Label

noncoding

End

39601344

Cancer

OV

Strand

+

Peptide

YILYNPVFPLLK

Modified Peptide

n[145]YILYNPVFPLLK

Peptide Length

12

ORF Length

70

Open Reading Frame (ORF)

LAEIYDGYRYILYNPVFPLLKTYPSNIIHIKPTYKVGQFHIICSRGKLKAVYMPINRLFKLWNSFPMTKQ

Conservation Score

0.498

PhyloCSF Frame 1

-5.032

No. of Spectra

1

CPC Coding Probability

0.047131

PhyloCSF Frame 2 

-5.126

CNTI Index

noncoding

Max Probability

0.9957

PhyloCSF Frame 3

-4.328

CNTI Score

-0.373618402