McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM178A-1:33

Chromosome

chr2

Gene Name

lnc-TMEM178A-1

Start

39518638

CPC Label

coding

End

39665343

Cancer

PRAD

Strand

+

Peptide

ELNATTQPDLDGICSWVQNGTLIK

Modified Peptide

ELNATTQPDLDGICSWVQNGTLIK

Peptide Length

24

ORF Length

126

Open Reading Frame (ORF)

LERTQGDMGTASLPGPLPQVVRVGNQEAPRHGATQVIMEQREEGLEQRECLEAKRWASERERAATDRAGCLGVSEASSCRRQAAGQRDLRTPDQDSKELNATTQPDLDGICSWVQNGTLIKINLDK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.818118

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

0

CNTI Score

-0.338669704