McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM174-1:7

Chromosome

chr5

Gene Name

lnc-TMEM174-1

Start

73291588

CPC Label

noncoding

End

73292261

Cancer

OV

Strand

+

Peptide

GAQDIDLK

Modified Peptide

n[145]GAQDIDLK

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

LCNNRKGAQDIDLKRRTQNSGRQRCPTFWLPWATLEEEK

Conservation Score

0.021

PhyloCSF Frame 1

-4.254

No. of Spectra

1

CPC Coding Probability

0.00756928

PhyloCSF Frame 2 

-4.72

CNTI Index

noncoding

Max Probability

0.328

PhyloCSF Frame 3

-5.36

CNTI Score

-0.412634042