McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM174-1:10

Chromosome

chr5

Gene Name

lnc-TMEM174-1

Start

73213935

CPC Label

noncoding

End

73292010

Cancer

OSCC

Strand

+

Peptide

LGQASIILGDIHLLSSNSR

Modified Peptide

n[145]LGQASIILGDIHLLSSNSR

Peptide Length

19

ORF Length

50

Open Reading Frame (ORF)

LGQASIILGDIHLLSSNSRASGSWAFRLGLELHYQLSWVSSLQRADRRTS

Conservation Score

1

PhyloCSF Frame 1

-4.227

No. of Spectra

5

CPC Coding Probability

0.274665

PhyloCSF Frame 2 

-4.674

CNTI Index

noncoding

Max Probability

0.9717

PhyloCSF Frame 3

-4.771

CNTI Score

-0.312615818