McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM173-3:3

Chromosome

chr5

Gene Name

lnc-TMEM173-3

Start

139640238

CPC Label

noncoding

End

139648196

Cancer

OV

Strand

-

Peptide

EGIGMWLDQVCSMSGGR

Modified Peptide

n[145]EGIGMWLDQVCSM[147]SGGR

Peptide Length

17

ORF Length

86

Open Reading Frame (ORF)

MFREGIGMWLDQVCSMSGGRAQEKERWTRACCGGSSGHTWIPFLRSICLGEPPPPPPNHLGRQETRAGWWWPHCLAGDPNPIPGRS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.130251

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4263

PhyloCSF Frame 3

0

CNTI Score

-0.323306409