McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM170B-5:4

Chromosome

chr6

Gene Name

lnc-TMEM170B-5

Start

11586886

CPC Label

noncoding

End

11623762

Cancer

CCRC

Strand

+

Peptide

TGVVSVCVK

Modified Peptide

n[230]TGVVSVCVK

Peptide Length

9

ORF Length

105

Open Reading Frame (ORF)

MTGVVSVCVKGKSHWIQVSQTPAPQPPLQYTGHGGQGPFLLPLRAWRVSLSLTGSLGSMLPFDDVPAHSFCALPAKIVCYLIELRKISRLAAKSNFYSCFHFYLM

Conservation Score

0.236

PhyloCSF Frame 1

0

No. of Spectra

69

CPC Coding Probability

0.107952

PhyloCSF Frame 2 

-5.225

CNTI Index

noncoding

Max Probability

0.9924

PhyloCSF Frame 3

-3.416

CNTI Score

-0.339761415