McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM170B-2:9

Chromosome

chr6

Gene Name

lnc-TMEM170B-2

Start

11514191

CPC Label

noncoding

End

11516466

Cancer

OV

Strand

+

Peptide

CHTTITEK

Modified Peptide

n[145]CHTTITEK

Peptide Length

8

ORF Length

58

Open Reading Frame (ORF)

LRKSNHRYWLGSLMNLRAREKDVGFLPPEADAGSLAVKCHTTITEKWEMNKEFWCDLA

Conservation Score

1

PhyloCSF Frame 1

-4.013

No. of Spectra

5

CPC Coding Probability

0.068568

PhyloCSF Frame 2 

-4.435

CNTI Index

noncoding

Max Probability

0.949

PhyloCSF Frame 3

-3.209

CNTI Score

-0.409512281