McDonnell Genome Institute

Washington University

Transcript

lnc-TMEM17-3:3

Chromosome

chr2

Gene Name

lnc-TMEM17-3

Start

62465375

CPC Label

noncoding

End

62516132

Cancer

EOGC

Strand

-

Peptide

LPILSSSDPPVSASQSAR

Modified Peptide

n[145]LPILSSSDPPVSASQSAR

Peptide Length

18

ORF Length

39

Open Reading Frame (ORF)

MLPILSSSDPPVSASQSARITGLSYCTRLLSHFLRNFSF

Conservation Score

0.147

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0488965

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.432030876